PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001086-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 367aa    MW: 40651.4 Da    PI: 4.9584
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001086-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box27.46.8e-0959105242
       zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                    + ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  NNU_001086-RA  59 RVWICEVCERAPAAFTCKADAAALCTTCDADIHSAnplarrHHRVPI 105
                    5689*****************************66899999877775 PP

2CCT71.52.1e-24298341144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea++lRY+eKrktRkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  NNU_001086-RA 298 REAKVLRYREKRKTRKFEKTIRYASRKAYAETRPRIKGRFAKRT 341
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.6841762IPR000315B-box-type zinc finger
SMARTSM003364.8E-41762IPR000315B-box-type zinc finger
CDDcd000211.48E-62062No hitNo description
PROSITE profilePS5011910.79358105IPR000315B-box-type zinc finger
PfamPF006431.2E-659105IPR000315B-box-type zinc finger
CDDcd000212.26E-861105No hitNo description
SMARTSM003368.9E-1063105IPR000315B-box-type zinc finger
PROSITE profilePS5101716.767298340IPR010402CCT domain
PfamPF062033.6E-18298340IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MMIKEEGGSG GTGGGGGWAR MCDSCCSAPC AVYCRADSAY LCAGCDARIH DQVVSQHERV  60
WICEVCERAP AAFTCKADAA ALCTTCDADI HSANPLARRH HRVPILPISG CLYGPSGMNP  120
GRPVRPEINI EDEFMTQEAD EEDEDEAASW LLLNPVKNNN QNNSGLLFGG EVDEYLDLVD  180
YNSCTENQYN DHYYQQNQCS VQQKNEGSDS VVPIQCLAVK ENQHNLQLEM DYEASKPGFS  240
YTASLSHSVS FSSIDASVVP DGIMNDISNS HSRPPKGTID LFSSPPLPMP PQFTPMDREA  300
KVLRYREKRK TRKFEKTIRY ASRKAYAETR PRIKGRFAKR TDVEVEVDQM FSTTVLAESG  360
YGIVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261698.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
RefseqXP_010261708.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
SwissprotQ965021e-127COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLF2WNM01e-174F2WNM0_AQUFO; CONSTANS-like protein
STRINGPOPTR_0017s14410.11e-163(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-75CONSTANS-like 2